Shop by goal

  • Metabolic Signalling
  • GH-Axis Research
  • Muscle & IGF Research
  • Tissue and Cellular Models
  • Regenerative Research
  • Cellular Senescence Research
  • Cognitive Research
  • Multi-Compound Blends
  • Accessories
  • All compounds →
  • Popular compounds

  • BPC-157
  • TB-500
  • GHK-Cu
  • Retatrutide
  • Semaglutide
  • Ipamorelin
  • All bestsellers →
  • Research resources

  • Research Areas
  • Certificates of Analysis
  • Research Glossary
  • Compare Compounds
  • Peptide Guides
  • Delivery Guide
  • Track Order
  • Recently viewed

  • All peptide guides
  • Crypto Blog
  • How to Reconstitute
  • Reconstitution Calculator
  • How to Store
  • Research
  • Certificates of Analysis
  • Sign In
  • Create Account
  • My Account
  • My Orders
  • My Referrals
  • Log Out
  • Track Order
  • Refer a Friend
  • Follow us on Twitter/X
  • How-to guides
    New-U Research Compounds — Buy IGF-1 LR3 at New-U Research Compounds. Laboratory research use only.

    Buy IGF-1 LR3

    Also known as Long R3 IGF-1, Long Arginine 3 IGF-1, LR3-IGF-1, Insulin-Like Growth Factor 1 Long R3, LONG R3 IGF-I, Recombinant Long R3 IGF-1

    IGF-1 LR3, 83-amino acid extended IGF-1 analogue with Arg3 substitution eliminating IGFBP binding for 3-fold enhanced potency and 20–30 hour half-life.

    In short: IGF-1 LR3, 83-amino acid extended IGF-1 analogue with Arg3 substitution eliminating IGFBP binding for 3-fold enhanced potency and 20–30 hour half-life. Research use only. Not for human use.

  • Arg3 substitution eliminates IGFBP binding increasing free bioavailable IGF-1 approximately 3-fold
  • 13-amino acid N-terminal extension enhances metabolic stability extending half-life to 20–30 hours
  • Full IGF-1R agonist activating PI3K/Akt/mTOR protein synthesis and RAS/RAF/MEK/ERK proliferation pathways
  • Bypasses hepatic GH/JAK2/STAT5 axis, direct peripheral tissue receptor activation
  • Promotes hyperplasia (new muscle cell formation) and mitogenesis via satellite cell activation
  • Inside New-U Research Compounds

    Why buy IGF-1 LR3 from New-U Research Compounds

  • >99% HPLC purity — every released sale batch independently verified by Janoshik Analytics & Freedom Diagnostics
  • 10-vial research packs & single-vial samples — a full study supply, or one vial to evaluate a compound
  • Direct-from-source pricing — no middleman markup
  • 6–14-day worldwide delivery — direct from source, discreet, cold-chain worldwide
  • Free shipping over $300 USD — card and cryptocurrency accepted
  • Published Certificates of Analysis for released sale batches listed on /coa
  • What is IGF-1 LR3?

    IGF-1 LR3 (Long Arginine 3 IGF-1) is an 83-amino-acid recombinant IGF-1 analog engineered to escape IGF-binding protein sequestration, giving it roughly 3× the potency and a 20-30 hour half-life of native IGF-1.

    IGF-1 LR3 activates the IGF-1 receptor directly - driving protein synthesis, cell proliferation, and glucose uptake - without getting trapped by circulating IGF-binding proteins.

    IGF-1 LR3 at a glance

    Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molecular weight 9,117.5 Da Purity >99% HPLC Form Lyophilised powder Category Muscle / Performance Storage Lyophilised powder: store in freezer (−20 °C). Reconstituted: refrigerate 1–6 °C, away from sunlight. Use within the validated stability window for the specific batch and formulation.

    IGF-1 LR3 pricing

    Research pack Per vial Price 10 vials 0.1mg $99 1 vials 0.1mg $37 10 vials 1mg $259 1 vials 1mg $100

    All packs are >99% HPLC research-grade material. Free shipping on orders over $300.

    Frequently asked questions

    Where can I buy IGF-1 LR3?

    IGF-1 LR3 (also known as Long R3 IGF-1) is available directly from New-U Research Compounds at https://new-u.io/peptide/igf-1-lr3. Every batch is independently third-party tested by Janoshik Analytics and Freedom Diagnostics to >99% HPLC purity, supplied as lyophilised research-grade material, and shipped direct from source worldwide (approximately 6–14 business days).

    How much does IGF-1 LR3 cost?

    IGF-1 LR3 starts at $37 for a 1-vial research pack (0.1mg per vial) at New-U Research Compounds, with 4 pack sizes available. Orders over $300 ship free.

    Is New-U IGF-1 LR3 third-party tested?

    Yes. Every IGF-1 LR3 batch is verified by independent laboratories (Janoshik Analytics and Freedom Diagnostics) for identity and purity, with a batch-linked Certificate of Analysis confirming >99% purity by HPLC area normalisation.

    How fast does IGF-1 LR3 ship, and do you ship internationally?

    IGF-1 LR3 ships direct from source, discreetly worldwide with cold-chain handling where required. Delivery is approximately 6–14 business days worldwide. Shipping is free on orders over $300. Card and cryptocurrency payments are accepted.

    Is it legal to buy IGF-1 LR3?

    In the United States, IGF-1 LR3 is sold strictly for laboratory and research purposes only. It is not approved by the FDA for human consumption and is not sold for that purpose. Regulatory status varies by jurisdiction — buyers are responsible for compliance in their own region.

    What is IGF-1 LR3 used for in research?

    IGF-1 LR3, 83-amino acid extended IGF-1 analogue with Arg3 substitution eliminating IGFBP binding for 3-fold enhanced potency and 20–30 hour half-life. New-U supplies IGF-1 LR3 as research-grade reference material for laboratory and in-vitro or animal-model investigation only. Mechanism, pharmacokinetics and study context are summarised on the IGF-1 LR3 research profile. Not for human use.

    What is the typical IGF-1 LR3 research dosage?

    Reconstitution volumes and dosing reported in the literature for IGF-1 LR3 are described in research-model terms only. New-U Research Compounds supplies IGF-1 LR3 strictly for laboratory research and does not provide human-use dosing guidance. Reconstitution math and study-reported ranges are covered on the full research profile.

    What do I use to reconstitute IGF-1 LR3?

    Lyophilised IGF-1 LR3 is reconstituted with bacteriostatic water — sterile water with 0.9% benzyl alcohol, the standard multi-use diluent for research peptides. New-U supplies USP-grade bacteriostatic water at https://new-u.io/peptide/bacteriostatic-water, and a free reconstitution calculator at https://new-u.io/tracker/calculator works out the volume for any peptide. Supplied for laboratory research only — not for human use.

    Can I buy IGF-1 LR3 online and how fast does it ship?

    Yes. IGF-1 LR3 can be ordered online directly from New-U Research Compounds with card or cryptocurrency, shipped direct from source discreetly worldwide. Delivery is approximately 6–14 business days worldwide. Free shipping applies to orders over $300.

    Can I buy IGF-1 LR3 in bulk?

    IGF-1 LR3 ships in 10-vial research packs as standard, in 4 pack sizes — the larger mg vials lower the per-mg cost. Multi-pack orders get direct-from-source pricing and free shipping over $300. For wholesale or recurring laboratory-supply volumes, contact New-U Research Compounds at https://new-u.io/contact.

    What should I look for when choosing where to buy IGF-1 LR3?

    For research-grade IGF-1 LR3, verify four things: (1) independent third-party purity testing with a batch-linked Certificate of Analysis — New-U uses Janoshik Analytics and Freedom Diagnostics at >99% HPLC; (2) lyophilised material with documented storage and handling; (3) transparent direct-from-source pricing rather than marketplace markup; and (4) clear research-use-only framing. New-U Research Compounds meets all four at https://new-u.io/peptide/igf-1-lr3.

    What is IGF-1 LR3?

    IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is an 83-amino-acid analogue of human IGF-1 with an N-terminal extension and an Arg substitution at position 3. Those modifications stop it binding IGF-binding proteins, greatly extending its active half-life versus native IGF-1. It is supplied as a lyophilised research-grade powder for laboratory use only.

    What does IGF-1 LR3 do?

    In research models IGF-1 LR3 activates the IGF-1 receptor (and PI3K/Akt and MAPK signalling) to drive cell growth, proliferation, differentiation and survival — with a much longer duration of action than native IGF-1 because it evades IGFBP sequestration. These are findings in cell and animal models; New-U supplies it for laboratory research only and implies no human effect.

    What is IGF-1 LR3 used for?

    IGF-1 LR3 is widely used as a cell-culture supplement to support proliferation and survival of cultured cells, and as a research tool for studying IGF-1-receptor signalling, hypertrophy and tissue-growth endpoints. New-U supplies it strictly for in-vitro and laboratory research; it is not for human use.

    Does IGF-1 LR3 show up on a drug test?

    Standard employment or clinical drug panels (including typical LabCorp steroid panels) do not screen for IGF-1 LR3 — it is a peptide, not a small-molecule steroid, and requires specialised assays. It is, however, on the WADA Prohibited List, and anti-doping authorities use dedicated tests for IGF-1 analogues. New-U supplies IGF-1 LR3 for laboratory research only, not for human or athletic use.

    What does "LR3" actually mean?

    "L" for the 13-amino-acid N-terminal extension (MFPAMPLSSLFVN), "R" for arginine, and "3" for position 3 of the IGF-1 sequence. So "LR3" literally means "the Long variant with an Arginine at position 3". Both modifications are needed to eliminate IGFBP binding and extend circulating half-life.

    How is IGF-1 LR3 different from IGF-1 DES?

    IGF-1 DES is the opposite end of the design spectrum - a truncated 67-residue form missing the N-terminal tripeptide GPE, which also dramatically reduces IGFBP binding. IGF-1 LR3 uses a 13-residue extension to achieve similar IGFBP resistance. LR3 has a much longer half-life (20-30 h vs minutes); DES produces more intense, shorter-duration local effects when injected site-specifically.

    Why is IGF-1 LR3 used in cell culture?

    Native IGF-1 is inefficient in cell culture because IGFBPs produced by the cells themselves can sequester it, reducing effective concentrations. IGF-1 LR3 escapes that sequestration and delivers consistent, reproducible growth-factor signalling. That is why it is an industry standard for bioprocessing and mammalian cell culture.

    How should IGF-1 LR3 be stored?

    Keep the lyophilised powder frozen at −20 °C (−80 °C for long-term storage). After reconstitution, refrigerate at 1-6 °C and protect from light. IGF-1 LR3 is a structured protein and is sensitive to repeated freeze-thaw cycles - aliquot if you need multiple aliquots from one reconstitution.

    How is IGF-1 LR3 reconstituted in the lab?

    Because IGF-1 LR3 is a structured protein that tends to aggregate in neutral aqueous solution, laboratory practice commonly reconstitutes it in dilute acetic acid (around 0.1%, ~10 mM) rather than plain water, which keeps it in a non-aggregated state; bacteriostatic or sterile water is also used. The vial is allowed to reach room temperature before opening to avoid condensation, then gently rolled rather than shaken. This is general handling guidance for research material, not a dosing instruction.

    Research references

    Independent literature and reference sources for IGF-1 LR3. Provided for scientific context — New-U Research Compounds supplies research-use-only material.

  • IGF-1 LR3 — Wikipedia
  • Superior potency of infused IGF-I analogues which bind poorly to IGF-binding proteins is maintained when administered by injection. Journal of Endocrinology.
  • IGF-I variants which bind poorly to IGF-binding proteins show more potent and prolonged hypoglycaemic action than native IGF-I in pigs and marmoset monkeys. Journal of Endocrinology.
  • Looking for mechanism of action, pharmacokinetics, dosage ranges and source references? See the full IGF-1 LR3 research profile or the IGF-1 LR3 research guide.

    Part of the Tissue repair & recovery research research area — explore related compounds, guides and sources.

    PRECISION. PURITY. PERFORMANCE.

    Research peptides at >99% HPLC-verified purity, third-party tested by Janoshik Analytical & Freedom Diagnostics, with Certificates of Analysis published per released batch. Supplied strictly for laboratory research use.

    Shop

  • All research compounds
  • Price list
  • Where to buy peptides
  • Compare compounds
  • Compare vial sizes
  • Affiliate programme
  • Research

  • Peptide 101
  • Published COAs
  • Research areas
  • Research blog
  • How-to guides
  • Peptide guides
  • Research glossary
  • Support

  • Track your order
  • Contact us
  • Shipping & delivery
  • FAQ
  • Community forum
  • Customer reviews
  • Refund policy
  • Ways to Pay

  • Google Pay
  • Apple Pay
  • Venmo
  • PayPal
  • Cryptocurrency
  • Cash App
  • Card payments
  • Bank transfer (SEPA)
  • Paying with crypto
  • Live crypto prices
  • Shop by goal

  • Metabolic Signalling
  • GH-Axis Research
  • Muscle & IGF Research
  • Tissue and Cellular Models
  • Regenerative Research
  • Cellular Senescence Research
  • Cognitive Research
  • Multi-Compound Blends
  • Accessories
  • Shop by compound

  • BPC-157
  • TB-500
  • GHK-Cu
  • Tesamorelin
  • Semaglutide
  • CJC-1295 (without DAC)
  • Ipamorelin
  • MOTS-C
  • All compounds →
  • Shop by region

  • United Kingdom
  • Australia
  • Canada
  • Canada (FR)
  • Ireland
  • Malta
  • Germany
  • France
  • Spain
  • Italy
  • Netherlands
  • Portugal
  • Greece
  • Austria
  • Poland
  • Sweden
  • Finland
  • Denmark
  • Norway
  • Croatia
  • Slovakia
  • Slovenia
  • Estonia
  • Latvia
  • Lithuania
  • Czechia
  • Hungary
  • Romania
  • Bulgaria
  • Belgium
  • Belgium (FR)
  • Luxembourg
  • United States
  • Northern Ireland
  • Research use only (RUO). All products are sold strictly for laboratory and research purposes — not for human or veterinary consumption. Purchasers must be 21 or older.

    All rights reserved. Copyright of New-U held with Hilxera Distribution Services LLC 2026.

    Website & business operated by Hilxera Distribution Services LLC. Registered in Wyoming, ID: 2026-001928701.

    © 2026 New-U Research Compounds · new-u.io

    [image: New-U Research Compounds logo and research peptide vial — Buy IGF-1 LR3 at New-U Research Compounds]

    Research use only — not for human consumption. All products are supplied strictly for laboratory research purposes.

    © 2026 New-U Research Compounds · new-u.io — Copyright held with Hilxera Distribution Services LLC. All rights reserved.